Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_11884_iso_7
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family TALE
Protein Properties Length: 455aa    MW: 50229.4 Da    PI: 5.9975
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                                           HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                              Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                                           k +yp++e++++L +++gL+ +q+ +WF N+R +
  cra_locus_11884_iso_7_len_2128_ver_3 404 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 437
                                           469*****************************87 PP

                                   ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
  cra_locus_11884_iso_7_len_2128_ver_3 358 ELKRELKQGYKEKIVDIREEIL 379
                                           9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF037894.4E-6358379IPR005539ELK domain
PROSITE profilePS512139.917358378IPR005539ELK domain
SMARTSM011880.0017358379IPR005539ELK domain
PROSITE profilePS5007111.726378441IPR001356Homeobox domain
SMARTSM003892.4E-11380445IPR001356Homeobox domain
CDDcd000869.42E-12381442No hitNo description
PfamPF059201.3E-17398437IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0009722Biological Processdetection of cytokinin stimulus
GO:0071345Biological Processcellular response to cytokine stimulus
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 455 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A1e-12381445872Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
No. Start End Sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010265705.10.0PREDICTED: homeobox protein knotted-1-like 3 isoform X1
SwissprotP480000.0KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLA0A103XGI50.0A0A103XGI5_CYNCS; ELK-like protein
STRINGVIT_04s0008g06130.t010.0(Vitis vinifera)